DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG30288

DIOPT Version :10

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:138 Identity:27/138 - (19%)
Similarity:47/138 - (34%) Gaps:50/138 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 IPEPPVPSTQPPLPETSTLYVP---PFKIVNKNDLEPVGGGKTTPGSMVTTTAGSVSGPVEPPAD 213
            :|:|...:..||    |..|.|   |:|            .|.:                ||.|.
  Fly   257 VPKPSTANADPP----SASYKPSQMPYK------------RKCS----------------EPSAT 289

  Fly   214 VPQKLVESKGSKEGSERQQQGGGSGTSSA--ANATAGERSEQRKEPNRSKEQTSGE--RKAPKED 274
            .|   :.:.|.:..:|        .||:|  :|..:|...:.|...:......|.:  :..||:|
  Fly   290 AP---LMNFGKRSANE--------STSAATISNTPSGNSKDNRSHHSSPPGNVSSKWAKFLPKDD 343

  Fly   275 QPKSHSPS 282
            :...::.|
  Fly   344 ETNENTDS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:463440
Tryp_SPc 149..406 CDD:214473 27/138 (20%)
CG30288NP_001097398.1 Tryp_SPc 45..270 CDD:238113 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.