DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG30286

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:134/293 - (45%) Gaps:58/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QTVEPSSGFNLLNECGKQVTNRIYGGE-IAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAH 191
            |.:||        :||......:...| .|.:.|.||:|.| :.|.:..|.|.|::.|.||||||
  Fly    20 QFLEP--------DCGYMSPEALQNEEHQAHISESPWMAYL-HKSGELVCGGTLVNHRFILTAAH 75

  Fly   192 CVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSC----ADAALDIAYEKIHVHPEYKEFSN 252
            |     :|:.:.|. |||||||..|..||    |...|    .|..:|:|:.    |..|...: 
  Fly    76 C-----IREDENLT-VRLGEFNSLTSIDC----NGSDCLPPSEDFEIDVAFR----HGGYSRTN- 125

  Fly   253 YKYNDIAIIRLKHPVSFTHFVMPICL-PNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSP-- 314
             :.:||.::||...|.:...:.|||| .|.:....:........:||||            ||  
  Fly   126 -RIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGR------------SPSE 177

  Fly   315 ----IKLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSR-- 373
                |...:|:..|:...|:|.   :.|.....|||...| :..:|:||||||:....|...|  
  Fly   178 AANHILKSIRVTRVNWGVCSKT---YWVDRRRDQICVSHE-SGVSCSGDSGGPMGQAIRLDGRVL 238

  Fly   374 WVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            :|..|:||||..:|   ..|:|:|||.|:.|||
  Fly   239 FVQVGIVSYGNAEC---LSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 87/270 (32%)
Tryp_SPc 150..409 CDD:238113 89/271 (33%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 88/266 (33%)
Tryp_SPc 39..268 CDD:214473 86/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.