DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG30187

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:289 Identity:84/289 - (29%)
Similarity:125/289 - (43%) Gaps:52/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKH 206
            ||..:..:|.||..|......|:| .|:|...:.|.|.||..|.:||||||:..:.|:.      
  Fly    28 CGINIALKITGGHNAAFQNSVWMA-AVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQS------ 85

  Fly   207 VRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTH 271
            |.||.:| |::|        ....|....:.:....|...|:       |||.:::|...|.|..
  Fly    86 VSLGAYN-KSDP--------ADRKDVITAVVHSSFDVRASYE-------NDIGLLKLSSDVIFNA 134

  Fly   272 FVMPICLP-NKSEPLTLAEGQMFSVSGWG------RTDLFNKYFINIHSPIKLKLRIPYVSNENC 329
            .:.|||:. |||....:...:.|...|||      .:|:.....:|            ::..|.|
  Fly   135 LIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILN------------HLDREEC 187

  Fly   330 TKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPL---MYFDRQHSRWVAYGVVSYGFTQCGMAG 391
            ...|   .|....||||||.. :.|||.|||||||   ::.....:|.|.:|::|.|.|.|...|
  Fly   188 YMEL---SVYPSEKQICAGVP-SGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQG 248

  Fly   392 KPAVYTNVAEYTDWIDSVVQQRKKSQQTQ 420
               |||::..:.|||...:::.....:.|
  Fly   249 ---VYTDLMSFADWIKMTIERLSIEDEPQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 79/266 (30%)
Tryp_SPc 150..409 CDD:238113 81/268 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 79/266 (30%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.