DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG30098

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:287 Identity:80/287 - (27%)
Similarity:128/287 - (44%) Gaps:62/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SSGFNLL--NECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQG 195
            |.|::.|  ::|......|:.||:.|.  ..||:|.|: ..|.:.|.|:||..|.:||||||.: 
  Fly    18 SYGYSQLLDSKCIALFRIRVIGGQNAR--RTPWMAYLI-RDNRFACGGSLIAYRFVLTAAHCTK- 78

  Fly   196 EGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAI 260
              :.|.   ..|||||::.....|             ....:|..:.:: .:|.:.:::.:|||:
  Fly    79 --INDN---LFVRLGEYDSSRTTD-------------GQTRSYRVVSIY-RHKNYIDFRNHDIAV 124

  Fly   261 IRLKHPVSFTHFVMPICLPNKSEPLTLAEG-QMFSVSGWGRTDLFNKYFINIHSPIKL-KLRIPY 323
            ::|...|.:..::.|||:...|...:||.. |.|:::|||:...:.|      .|..| ::.:..
  Fly   125 LKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYK------MPTTLQEMSLRR 183

  Fly   324 VSNENCTKILEGFGVRLGPK-QICAGG--EFAKDTCAGDSGGPLMYFDRQHSRWVAYG----VVS 381
            |.||.|       ||   |. .||...  ::|   |.|||||||       ...|.||    .|.
  Fly   184 VRNEYC-------GV---PSLSICCWNPVQYA---CFGDSGGPL-------GSLVKYGHKTIYVQ 228

  Fly   382 YGFTQ--CGMAGKPAVYTNVAEYTDWI 406
            :|.|.  .|.....:.|.::..|..|:
  Fly   229 FGVTNSVTGNCDGYSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 75/267 (28%)
Tryp_SPc 150..409 CDD:238113 75/268 (28%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 75/266 (28%)
Tryp_SPc 37..258 CDD:238113 75/268 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.