DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG30090

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:293 Identity:99/293 - (33%)
Similarity:141/293 - (48%) Gaps:48/293 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 VEPSSGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCV- 193
            :||..|..     ...:..:|.||..|.::..||:| .:::|....|.|.||..|.:||||||| 
  Fly    25 LEPRCGLT-----ANTIAFKIIGGRDAIINSNPWMA-YIHSSVKLICGGTLITQRFVLTAAHCVN 83

  Fly   194 QGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAA----LDIAYEKIHVHPEYKEFSNYK 254
            :|..|:       |||||::.....||    |...|...|    :|:|:.    |.::.|..|  
  Fly    84 EGSAVK-------VRLGEYDDTATEDC----NSKICIPRAEEHDVDMAFR----HGKFSEIKN-- 131

  Fly   255 YNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEG-QMFSVSGWGRTDLFNKYFINIHSPIKLK 318
            .||||::||...|:|...:.|||:...:....|.:. :.|..:|||.|.......:         
  Fly   132 LNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGV--------- 187

  Fly   319 LRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLM----YFDRQHSRWVAYGV 379
            |:|..:...|.::.::..|..:...|||| |....|||.|||||||.    :.|:.  |.|.:||
  Fly   188 LQITQLQRYNSSQCMQALGRLVQQNQICA-GRLGSDTCNGDSGGPLFQTVRHMDKM--RPVQFGV 249

  Fly   380 VSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQ 412
            ||||..:|...|   |||:|..|.|||.:||||
  Fly   250 VSYGSRECSGIG---VYTDVYSYADWIATVVQQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 90/266 (34%)
Tryp_SPc 150..409 CDD:238113 92/268 (34%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 90/266 (34%)
Tryp_SPc 40..276 CDD:238113 92/268 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.