DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and TPSD1

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:247 Identity:75/247 - (30%)
Similarity:114/247 - (46%) Gaps:46/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 VEPSSGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYNSN--DYGCSGALIDDRHILTAAHC 192
            |.|:.| ..|.:.|      |.||:.|...::||...|.....  .:.|.|:||..:.:||||||
Human    25 VAPAPG-QALQQTG------IVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQWVLTAAHC 82

  Fly   193 VQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYND 257
            |:.: ::|...|: |:|.|             .:|...|..|.::  :|.|||::  :......|
Human    83 VEPD-IKDLAALR-VQLRE-------------QHLYYQDQLLPVS--RIIVHPQF--YIIQTGAD 128

  Fly   258 IAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLR-- 320
            ||::.|:.||:.:..:..:.||..||  |...|....|:|||..|      .|:|.|....|:  
Human   129 IALLELEEPVNISSHIHTVTLPPASE--TFPPGMPCWVTGWGDVD------NNVHLPPPYPLKEV 185

  Fly   321 -IPYVSNENC-----TKILEGFGVRL-GPKQICAGGEFAKDTCAGDSGGPLM 365
             :|.|.|..|     |.:..|...:: ....:|||.| ..|:|.|||||||:
Human   186 EVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSE-NHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 70/228 (31%)
Tryp_SPc 150..409 CDD:238113 70/227 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 70/227 (31%)
Tryp_SPc 38..240 CDD:214473 70/227 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152812
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.