DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and T22A3.6

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:154 Identity:35/154 - (22%)
Similarity:51/154 - (33%) Gaps:31/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IPNETKRGVCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQ-------CEVE--------QQVSEA 79
            |||.|     .::|...:.....|.. ||.|..||.:...       |.|.        |....:
 Worm   117 IPNST-----FDISDSSSSSYSMNRI-LPDEYENFCRNPDKNPLGPWCYVGNDTTAPCFQPCRPS 175

  Fly    80 QGSYESLVCCPANGQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNECGK 144
            ..:....||...:|    ||...:...:......:...||...|....:.|.||....:.....|
 Worm   176 TETSSDFVCLNRDG----FPYTDYDMSDILDLPQLIGIFKDVDLMYESRFVLPSLPDGVQRLSTK 236

  Fly   145 QVTNRIYGGEIAELDEF-PWLALL 167
            ...|:   |.||  :.| ||:|:|
 Worm   237 SCINK---GHIA--NHFGPWIAVL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855 15/73 (21%)
Tryp_SPc 149..406 CDD:214473 8/20 (40%)
Tryp_SPc 150..409 CDD:238113 8/19 (42%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.