DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and try-4

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:304 Identity:80/304 - (26%)
Similarity:124/304 - (40%) Gaps:65/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LLNECGKQVTNRIYGGEIAELDEFPW-LALLVYNSNDYGCSGALIDDRHILTAAH----CVQGEG 197
            |:..||.|..::|        ..||| ::..|...|..|  |::|...||:||||    .:...|
 Worm    43 LMESCGIQQESKI--------KNFPWAVSFTVDGVNRLG--GSIISPYHIITAAHGFITTIGSRG 97

  Fly   198 ------------------VRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIH-- 242
                              ::..:..:.|..|...::...|  :.||...|..:  |:.:.|:.  
 Worm    98 NLCENKNWKKPNSSIYRSIKFLRDTRKVAYGGTCIRGHTD--KYPNDPRCKKS--DVIHNKVRAV 158

  Fly   243 -VHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNK 306
             |..|:...:..|.:|.||:.::..:.|:..|.|||||..:...|    :..:|.||||:.:||:
 Worm   159 LVDGEFASSNCLKGHDWAIVEVEKRIHFSENVRPICLPRPNMYYT----KSLAVPGWGRSYIFNE 219

  Fly   307 YFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQ----ICA-----GGEFAKDTCAGDSGG 362
            ....||       .||...:.:|.:   .:..|| |..    |||     ....|..||.|||||
 Worm   220 SGPLIH-------EIPMRIDRDCKR---PWSDRL-PADADDFICATSMNVSNYSAPRTCHGDSGG 273

  Fly   363 PLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            .|.|.|..:.|.....:.|:|...| .:...|.:|.|..|.:.|
 Worm   274 GLEYRDDNYGRAFLIAITSFGTRGC-PSNMLARFTRVDMYLNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 75/291 (26%)
Tryp_SPc 150..409 CDD:238113 76/292 (26%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 76/296 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.