DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and try-10

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:268 Identity:62/268 - (23%)
Similarity:100/268 - (37%) Gaps:81/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 CSGALIDDRHILTAAHCV-QGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYE 239
            |.|.||....::|:|||| .|:   |......|.||:.::....|..:|               .
 Worm   104 CGGVLIAPSIVITSAHCVFSGD---DFAVTAKVTLGDVHLNKHDDGEQE---------------F 150

  Fly   240 KIHVHPEYKEFSN---YKYNDIAIIRLKHPVSFTHFVMPICLP------------NKSEPLT--L 287
            :.|.....|:|.|   ...:|:|:|.|.......|  .|:.|.            .::.|||  .
 Worm   151 RSHAMAISKKFFNDASEANDDVAVIFLPQRADVCH--SPLSLQIAKLPSTGSVNFKETAPLTQLQ 213

  Fly   288 AEGQMFSVSGWGRTDLFN---KYFINIHS-PIKLKLRIPYVSNENCTKILEGFGVRLGPKQ--IC 346
            .|..:..|:|||:|:  |   ||..::.. .:.|.:|                  |:|.::  |.
 Worm   214 LETSVCYVAGWGKTE--NKTAKYSDSVRQMMVNLSVR------------------RIGKRKYLIA 258

  Fly   347 AGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGK-----PAVYTNVA---EYT 403
            .....:...|.||||.|:..|  .:.:.:..|.|::    .|...|     |:.:.:..   |||
 Worm   259 KAVTGSSRACMGDSGSPVYCF--VNGKRILVGTVAH----IGSFSKMSEQDPSNHISFCRDFEYT 317

  Fly   404 ---DWIDS 408
               ||.:|
 Worm   318 FVSDWRES 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 60/264 (23%)
Tryp_SPc 150..409 CDD:238113 62/268 (23%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 52/227 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.