DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Tpsb2

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:272 Identity:90/272 - (33%)
Similarity:130/272 - (47%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IYGGEIAELDEFPWLALLVYNSN--DYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEF 212
            |.||..|...::||...|.:..|  .:.|.|:||..:.:||||||| |..::..| |..|:|.| 
Mouse    32 IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCV-GPHIKSPQ-LFRVQLRE- 93

  Fly   213 NVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPIC 277
                        .||...|..|.:  .:|.|||.|  ::.....|:|::.|:.||:.:..:.||.
Mouse    94 ------------QYLYYGDQLLSL--NRIVVHPHY--YTAEGGADVALLELEVPVNVSTHLHPIS 142

  Fly   278 LPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGP 342
            ||..||  |...|....|:|||  |:.|...:....|:| ::::|.|.|..|.:... .|:..|.
Mouse   143 LPPASE--TFPPGTSCWVTGWG--DIDNDEPLPPPYPLK-QVKVPIVENSLCDRKYH-TGLYTGD 201

  Fly   343 K-------QICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVA 400
            .       .:|||.. .:|:|.|||||||:.  :....|:..||||:| ..|....||.:||.|.
Mouse   202 DFPIVHDGMLCAGNT-RRDSCQGDSGGPLVC--KVKGTWLQAGVVSWG-EGCAQPNKPGIYTRVT 262

  Fly   401 EYTDWIDSVVQQ 412
            .|.|||...|.:
Mouse   263 YYLDWIHRYVPE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 87/264 (33%)
Tryp_SPc 150..409 CDD:238113 89/267 (33%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 89/266 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.