DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG43742

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:286 Identity:94/286 - (32%)
Similarity:137/286 - (47%) Gaps:63/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LLNE-CGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDR 201
            ||:| |..::|.|:..|..|...:|  :|.| ||::::.|.|:||..:::||||||     |||.
  Fly    22 LLDENCKVKITYRVANGHTAITSQF--MAAL-YNNSEFFCGGSLIHKQYVLTAAHC-----VRDL 78

  Fly   202 QGLKHVRLGEFNVKTE-PDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKH 265
            ..:. |.|||.|.... |.|    .::...:|       |:.:||.:  ..|...||||::||:.
  Fly    79 DEVT-VHLGENNRSCPIPVC----KHVLRLNA-------KVILHPNF--HGNIFLNDIALLRLER 129

  Fly   266 PVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCT 330
            .|.|...:.|||: ...|.:|......|:..|||:|:                       :.|.:
  Fly   130 EVIFEAHIRPICI-ILDEDVTSNNQNNFTAYGWGKTE-----------------------HGNIS 170

  Fly   331 KILEGFG-VRLGPKQIC-------AGGEFAKDTCAGDSGGPLM--YFDRQHSRWVAYGVVSYGFT 385
            .:|.... ||| ||.:|       ..|..:.|||..||||||:  :..|..||.:.:|:.|||..
  Fly   171 DVLSFIDLVRL-PKSMCYQNINTICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDA 234

  Fly   386 QC-GMAGKPAVYTNVAEYTDWIDSVV 410
            :| |:.|   |||:|..|..||.|||
  Fly   235 ECSGLFG---VYTDVNAYKSWIASVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 84/268 (31%)
Tryp_SPc 150..409 CDD:238113 85/270 (31%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 84/268 (31%)
Tryp_SPc 35..256 CDD:238113 85/270 (31%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.