DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and CG43124

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:291 Identity:73/291 - (25%)
Similarity:105/291 - (36%) Gaps:90/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QTVEPSSGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHC 192
            ||:|        .:|...: .||.|...|     ||||.::.:|... |:||||::.::||||.|
  Fly    21 QTLE--------EDCVDHM-ERINGSSYA-----PWLAEILSDSKVI-CAGALINNLYVLTAASC 70

  Fly   193 VQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEY---KEFSNYK 254
                 .::.:.|. ||||                    ....|.:||...|...|   ..|....
  Fly    71 -----FKENEKLT-VRLG--------------------SGYFDKSYENFRVTKAYFWMTHFPANN 109

  Fly   255 YNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNK-----YFI-NIHS 313
            .|::.|.||:..|.|...:.|:|:....:.|.||.          ..::.|:     ||. ||..
  Fly   110 TNNLCIFRLQTEVEFKTHIRPMCITKSPKSLGLAT----------TFEIINEKPKMWYFCKNIKG 164

  Fly   314 PIKLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYG 378
                 |...||..||..|           .|....|....:|.   |.||.       ...|.||
  Fly   165 -----LFCKYVFGENEEK-----------WQSKPTGSPWTETI---SNGPF-------KGLVRYG 203

  Fly   379 VVSYGFTQCGMAGKPAVYTNVAEYTDWIDSV 409
            ::||...:.    ...||.||..:.:||..:
  Fly   204 ILSYRDNKT----YDEVYINVMSHINWIAQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 67/265 (25%)
Tryp_SPc 150..409 CDD:238113 68/267 (25%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 33/118 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.