DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:355 Identity:105/355 - (29%)
Similarity:156/355 - (43%) Gaps:76/355 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AQGSYESLVCCPANGQD--YLFPVLQFSKFEYRRFLDVTARF----------KRKKLKRRIQTVE 131
            |:..|::      ||..  |..||...:...|...::|..|:          |...:....|.::
Zfish   232 AESGYDT------NGSTVFYSIPVSDVTNLPYTSNVNVKGRWVFRVDNSSEVKGSCINTNSQALD 290

  Fly   132 -PSSGFNLLNECG---KQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHC 192
             ||:..     ||   ...:|...||:.:....:||.|.|.:.|.. .|.|:||:...:|:||||
Zfish   291 SPSAAV-----CGIIPVNSSNGTVGGQNSSAVHWPWQASLYWYSGQ-TCGGSLINKEWVLSAAHC 349

  Fly   193 VQGEGVRDRQGL-KHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYN 256
            ..|:    |.|. ..|.||.   ||:..  .:|:.:|.:..|       :..||.|.  .|...|
Zfish   350 FNGQ----RNGFYLTVILGP---KTQNK--YDPSRISRSVKA-------VIKHPYYN--PNTNDN 396

  Fly   257 DIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFS--VSGWGRTDLFNKYFINIHSPIKL-- 317
            |||::||..|::||..:.|:||        .|||.:|:  ...|..|      :.||...:.|  
Zfish   397 DIALVRLSFPITFTDSIRPVCL--------AAEGSVFNSDTESWITT------WRNISDGVPLPS 447

  Fly   318 -----KLRIPYVSNENCTKILEGFGVRLGPKQICAG-GEFAKDTCAGDSGGPLMYFDRQHSRWVA 376
                 ::.:|.:.|..| ..|.|.| .:....|||| .:..||.|.||||||::  ..|.|.||.
Zfish   448 PKIFQEVEVPVIGNRQC-NCLYGVG-SITDNMICAGLLKEGKDLCQGDSGGPMV--SNQSSVWVQ 508

  Fly   377 YGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            .|:||:| :.|..:..|.|||.|:.|.:||
Zfish   509 SGIVSFG-SGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855 2/9 (22%)
Tryp_SPc 149..406 CDD:214473 86/267 (32%)
Tryp_SPc 150..409 CDD:238113 88/268 (33%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 10/45 (22%)
Tryp_SPc 309..537 CDD:238113 86/265 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.