DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and Tpsab1

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:272 Identity:88/272 - (32%)
Similarity:134/272 - (49%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IYGGEIAELDEFPWLALLVYNSND----YGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLG 210
            |.||:.|..:::||...|  .:||    :.|.|:||..:.:||||||| |..|.|...:: |:| 
Mouse    29 IVGGQEAHGNKWPWQVSL--RANDTYWMHFCGGSLIHPQWVLTAAHCV-GPDVADPNKVR-VQL- 88

  Fly   211 EFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMP 275
                        ...||...|..:.::  :|..||::  :......|||:::|.:||:.:.:|.|
Mouse    89 ------------RKQYLYYHDHLMTVS--QIITHPDF--YIVQDGADIALLKLTNPVNISDYVHP 137

  Fly   276 ICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLK-LRIPYVSNENC-----TKILE 334
            :.||..||  |...|.:..|:|||..|    ..:|:..|..|| :::|.:.|..|     ..::.
Mouse   138 VPLPPASE--TFPSGTLCWVTGWGNID----NGVNLPPPFPLKEVQVPIIENHLCDLKYHKGLIT 196

  Fly   335 GFGVRL-GPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTN 398
            |..|.: ....:|||.| ..|:|.|||||||:.  :....|:..||||:| ..|....:|.:||.
Mouse   197 GDNVHIVRDDMLCAGNE-GHDSCQGDSGGPLVC--KVEDTWLQAGVVSWG-EGCAQPNRPGIYTR 257

  Fly   399 VAEYTDWIDSVV 410
            |..|.|||...|
Mouse   258 VTYYLDWIHHYV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 85/266 (32%)
Tryp_SPc 150..409 CDD:238113 87/269 (32%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 86/267 (32%)
Tryp_SPc 29..265 CDD:214473 85/266 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.