DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and proc.2

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:276 Identity:101/276 - (36%)
Similarity:136/276 - (49%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RIYGGEIAELDEFPWLALLVYNSNDYG-CSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEF 212
            ||.||...||.:.|| .:|:.|:..:| |.|:||..|.:|:||||.:.      |...||.:|::
 Frog   435 RIVGGMRCELGQCPW-QVLIRNNRGFGFCGGSLISSRWVLSAAHCFES------QIPHHVTIGDY 492

  Fly   213 NVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEY-KEFSNYKYNDIAIIRLKHPVSFTHFVMPI 276
            :.... |..|:           .||..::..||.| .||.::   |||::.|:.|..|..:..||
 Frog   493 DTYRR-DMDEQ-----------KIAVLQVFSHPNYLAEFYDH---DIALLFLRSPAMFGEYSRPI 542

  Fly   277 CLPNK--SEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVR 339
            ||||.  .:.|| .|||...|||||.|..|..|     :...||:|:|.||.|.|....|..   
 Frog   543 CLPNPGLGKMLT-QEGQTGQVSGWGATRQFGPY-----TRFLLKVRLPIVSQETCMASTENI--- 598

  Fly   340 LGPKQICAG-GEFAKDTCAGDSGGPL-MYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEY 402
            |.....||| .|..||.|:||||||. :.|   |..|...||||:| ..|...||..|||.||.|
 Frog   599 LTGNMFCAGYKEGVKDACSGDSGGPFAVLF---HDTWFLVGVVSWG-DGCAEKGKYGVYTRVANY 659

  Fly   403 TDWIDSVVQQRKKSQQ 418
            ..||...:.:.::.::
 Frog   660 MPWIKETIVEIEEGEE 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 99/262 (38%)
Tryp_SPc 150..409 CDD:238113 100/264 (38%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:373209
Tryp_SPc 436..666 CDD:238113 100/264 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.