DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and zgc:163079

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:289 Identity:80/289 - (27%)
Similarity:125/289 - (43%) Gaps:73/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CGKQVTN-RIYGGEIAELDEFPWLALL-VYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGL 204
            ||:...| :|.||..|....:||.|.: :..:.::.|.|:||:...:||.|..            
Zfish    27 CGRAPLNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKV------------ 79

  Fly   205 KHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYE------KIHVHPEYKEFSNYKYNDIAIIRL 263
                   |.:....|.:.   ||..........||      ||..||.|....    :::|:::|
Zfish    80 -------FALMPASDIVV---YLGRQTQNGSNPYEISRTVTKIIKHPNYNSLD----SNLALLKL 130

  Fly   264 KHPVSFTHFVMPICLPNKSEPLTLAEGQMFS------VSGWGRTDLFNKYFINIHSPIK------ 316
            ..||:|:.::.|:||        .|.|.:|.      |:|||        ::|..:.::      
Zfish   131 SSPVTFSDYIKPVCL--------AAAGSVFVDGTASWVTGWG--------YLNRPATVEEIMLPD 179

  Fly   317 --LKLRIPYVSNENCTKILEGFGVRLGPKQICAG--GEFAKDTCAGDSGGPLMYFDRQHSRWVAY 377
              .::..|.|:|..|.   ..:|..:..|.:|||  .|..|..||||.||||:.  :|.:.|:..
Zfish   180 VLQEVEAPIVNNFECN---AAYGGIITNKLLCAGYLNEDGKAPCAGDVGGPLVI--KQGAIWIQS 239

  Fly   378 GVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406
            |||..|:  ||:.|.|.:|..|:||.|||
Zfish   240 GVVVSGY--CGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 75/279 (27%)
Tryp_SPc 150..409 CDD:238113 77/280 (28%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 75/279 (27%)
Tryp_SPc 36..267 CDD:238113 77/280 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.