DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9737 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:312 Identity:79/312 - (25%)
Similarity:128/312 - (41%) Gaps:73/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LLNECGK-QVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDR 201
            |...||: .:..||.||..|....:||...:...||.:.|.|::|....:|:||||.        
Zfish    19 LAQVCGRPPLGKRIVGGVEASPGSWPWQVDIQMGSNGHVCGGSIIAKNWVLSAAHCF-------- 75

  Fly   202 QGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKY----------- 255
                                  ||   .::.:....|...|:...|.:|....|           
Zfish    76 ----------------------PN---PSEVSAYTLYMGRHLLNGYNQFEKVSYVQRVVIPEGYT 115

  Fly   256 -----NDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPI 315
                 .|:|:::|:.|||:|..:.|:|||  ........|.:..|:|||.    .:..:::....
Zfish   116 DPQGGRDVALVQLRAPVSWTDRIQPVCLP--FADFQFNSGTLCYVTGWGH----KQEGVSLTGAA 174

  Fly   316 KLK-LRIPYVSNENCT---KIL--EGFGVRLGPKQICAG-GEFAKDTCAGDSGGPLMYFDRQHSR 373
            .|: :.:|.:...:|.   :||  :...|.:....|||| .|..||:|.|||||||: ....:..
Zfish   175 ALREVEVPIIDQSSCQFMYQILSSDSSTVDILSDMICAGYKEGGKDSCQGDSGGPLV-CPVGNGT 238

  Fly   374 WVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQ--------RKKSQ 417
            |:..||||:|. .|....:|.:|:.|:.:...|.:.|.:        |.:||
Zfish   239 WIQAGVVSFGL-GCAQKNRPGIYSRVSSFEKLIRTTVPEAYFLGHACRSESQ 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 71/279 (25%)
Tryp_SPc 150..409 CDD:238113 71/281 (25%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 71/281 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.