DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CecC and CecA2

DIOPT Version :10

Sequence 1:NP_524591.1 Gene:CecC / 43599 FlyBaseID:FBgn0000279 Length:63 Species:Drosophila melanogaster
Sequence 2:NP_524589.1 Gene:CecA2 / 43597 FlyBaseID:FBgn0000277 Length:63 Species:Drosophila melanogaster


Alignment Length:63 Identity:58/63 - (92%)
Similarity:62/63 - (98%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGIAQQAANVAATARG 63
            ||||.|||||||||||:|||||||||||:||:|||:|||||||||||||||||||||||||||
  Fly     1 MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CecCNP_524591.1 Cecropin 28..57 CDD:425572 25/28 (89%)
CecA2NP_524589.1 Cecropin 28..57 CDD:425572 25/28 (89%)

Return to query results.
Submit another query.