DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CecB and CecC

DIOPT Version :10

Sequence 1:NP_524590.1 Gene:CecB / 43598 FlyBaseID:FBgn0000278 Length:63 Species:Drosophila melanogaster
Sequence 2:NP_524591.1 Gene:CecC / 43599 FlyBaseID:FBgn0000279 Length:63 Species:Drosophila melanogaster


Alignment Length:63 Identity:56/63 - (88%)
Similarity:60/63 - (95%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFNKIFVFVALILAISLGNSEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG 63
            |||.|||||||||||||:|.||||||:||||:|||||||||||:||.||||||||||||||||
  Fly     1 MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGIAQQAANVAATARG 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CecBNP_524590.1 Cecropin 28..57 CDD:425572 25/28 (89%)
CecCNP_524591.1 Cecropin 28..57 CDD:425572 25/28 (89%)

Return to query results.
Submit another query.