DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CecB and CecA2

DIOPT Version :9

Sequence 1:NP_524590.1 Gene:CecB / 43598 FlyBaseID:FBgn0000278 Length:63 Species:Drosophila melanogaster
Sequence 2:NP_524589.1 Gene:CecA2 / 43597 FlyBaseID:FBgn0000277 Length:63 Species:Drosophila melanogaster


Alignment Length:63 Identity:53/63 - (84%)
Similarity:59/63 - (93%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFNKIFVFVALILAISLGNSEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG 63
            |||..|||||||||||::|.||||||:|:||||||:|||||||:||.||||||||||||||||
  Fly     1 MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CecBNP_524590.1 Cecropin 29..61 CDD:278690 27/31 (87%)
CecA2NP_524589.1 Cecropin 28..61 CDD:306727 28/32 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469165
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBF1
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I7678
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014291
OrthoInspector 1 1.000 - - otm49915
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR38329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.