DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CecB and CecA1

DIOPT Version :10

Sequence 1:NP_524590.1 Gene:CecB / 43598 FlyBaseID:FBgn0000278 Length:63 Species:Drosophila melanogaster
Sequence 2:NP_524588.1 Gene:CecA1 / 43596 FlyBaseID:FBgn0000276 Length:63 Species:Drosophila melanogaster


Alignment Length:63 Identity:53/63 - (84%)
Similarity:59/63 - (93%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFNKIFVFVALILAISLGNSEAGWLRKLGKKIERIGQHTRDASIQVLGIAQQAANVAATARG 63
            |||..|||||||||||::|.||||||:|:||||||:|||||||:||.||||||||||||||||
  Fly     1 MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CecBNP_524590.1 Cecropin 28..57 CDD:425572 24/28 (86%)
CecA1NP_524588.1 Cecropin 28..57 CDD:425572 24/28 (86%)

Return to query results.
Submit another query.