DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CecA2 and LOC1272277

DIOPT Version :10

Sequence 1:NP_524589.1 Gene:CecA2 / 43597 FlyBaseID:FBgn0000277 Length:63 Species:Drosophila melanogaster
Sequence 2:XP_311222.4 Gene:LOC1272277 / 1272277 VectorBaseID:AGAMI1_007092 Length:59 Species:Anopheles gambiae


Alignment Length:51 Identity:19/51 - (37%)
Similarity:30/51 - (58%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIA 51
            |||..||:...:::|..:||:|....||..||:|..|:...:|..:||.:|
Mosquito     1 MNFKLIFLVALVLMAAFLGQTEGRRFKKFLKKVEGAGRRVANAAQKGLPLA 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CecA2NP_524589.1 Cecropin 28..57 CDD:425572 9/24 (38%)
LOC1272277XP_311222.4 Cecropin 28..57 CDD:425572 9/24 (38%)

Return to query results.
Submit another query.