DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CecA1 and CecC

DIOPT Version :9

Sequence 1:NP_524588.1 Gene:CecA1 / 43596 FlyBaseID:FBgn0000276 Length:63 Species:Drosophila melanogaster
Sequence 2:NP_524591.1 Gene:CecC / 43599 FlyBaseID:FBgn0000279 Length:63 Species:Drosophila melanogaster


Alignment Length:63 Identity:58/63 - (92%)
Similarity:62/63 - (98%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG 63
            ||||.|||||||||||:|||||||||||:||:|||:|||||||||||||||||||||||||||
  Fly     1 MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGIAQQAANVAATARG 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CecA1NP_524588.1 Cecropin 28..61 CDD:306727 29/32 (91%)
CecCNP_524591.1 Cecropin 28..57 CDD:395210 25/28 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469164
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBF1
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I7678
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014291
OrthoInspector 1 1.000 - - otm49915
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR38329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.