DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS7 and RPS7A

DIOPT Version :9

Sequence 1:NP_651782.1 Gene:RpS7 / 43594 FlyBaseID:FBgn0039757 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_014739.1 Gene:RPS7A / 854263 SGDID:S000005622 Length:190 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:94/176 - (53%)
Similarity:123/176 - (69%) Gaps:4/176 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PDDFEKSIAQALVELEANS-DLKPYLRDLHITRAREIEF-GSKKAVIIYVPIPQQKVFQKIQIIL 77
            |.:.|..:|||.||||.:| :||..||.|.....|||:. |.|||:.|:||:|....|.|:|..|
Yeast    13 PTELELQVAQAFVELENSSPELKAELRPLQFKSIREIDVAGGKKALAIFVPVPSLAGFHKVQTKL 77

  Fly    78 VRELEKKFSGKHVVVIAERKILPKPTRKARNPLKQKRPRSRTLTAVYDAILEDLVFPAEIVGKRI 142
            .|||||||..:||:.:|||:|||||:|.:|.  .||||||||||||:|.||||||||.||||||:
Yeast    78 TRELEKKFQDRHVIFLAERRILPKPSRTSRQ--VQKRPRSRTLTAVHDKILEDLVFPTEIVGKRV 140

  Fly   143 RVKLDGSQLVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFP 188
            |..:.|:::.||.||......|::|:::|.:||.||||:.:.||.|
Yeast   141 RYLVGGNKIQKVLLDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS7NP_651782.1 Ribosomal_S7e 6..189 CDD:396003 94/176 (53%)
RPS7ANP_014739.1 Ribosomal_S7e 6..186 CDD:396003 93/174 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343194
Domainoid 1 1.000 176 1.000 Domainoid score I731
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I976
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53491
OrthoFinder 1 1.000 - - FOG0003109
OrthoInspector 1 1.000 - - otm46808
orthoMCL 1 0.900 - - OOG6_101127
Panther 1 1.100 - - LDO PTHR11278
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1249
SonicParanoid 1 1.000 - - X2081
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.