DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS7 and AT1G48830

DIOPT Version :10

Sequence 1:NP_651782.1 Gene:RpS7 / 43594 FlyBaseID:FBgn0039757 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_175314.1 Gene:AT1G48830 / 841305 AraportID:AT1G48830 Length:191 Species:Arabidopsis thaliana


Alignment Length:185 Identity:90/185 - (48%)
Similarity:135/185 - (72%) Gaps:6/185 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIIKPGGSDPDDFEKSIAQALVELE-ANSDLKPYLRDLHITRAREIEF-GSKKAVIIYVPIPQQK 68
            ||.|..|.:..:.::.:|||..:|| .|.:||..|:||::..|.:::. |.:||:::.||...:|
plant     7 KIHKEKGVELSELDEQVAQAFFDLENTNQELKSELKDLYVNSAVQVDISGGRKAIVVNVPYRLRK 71

  Fly    69 VFQKIQIILVRELEKKFSGKHVVVIAERKILPKPTRKARNPLKQKRPRSRTLTAVYDAILEDLVF 133
            .::||.:.||||||||||||.|::||.|:|: :|.:|..   ..||||:||||:|::|||:|:|.
plant    72 AYRKIHVRLVRELEKKFSGKDVILIATRRIV-RPPKKGS---AAKRPRNRTLTSVHEAILDDVVL 132

  Fly   134 PAEIVGKRIRVKLDGSQLVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFP 188
            ||||||||.|.:|||::::||.||..::...|:||:.|::|||||||:||.||||
plant   133 PAEIVGKRTRYRLDGTKIMKVFLDPKERNNTEYKVEAFSAVYKKLTGKDVVFEFP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS7NP_651782.1 Ribosomal_S7e 6..187 CDD:460135 87/182 (48%)
AT1G48830NP_175314.1 Ribosomal_S7e 7..186 CDD:460135 87/182 (48%)

Return to query results.
Submit another query.