DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS7 and AT5G16130

DIOPT Version :9

Sequence 1:NP_651782.1 Gene:RpS7 / 43594 FlyBaseID:FBgn0039757 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_197117.1 Gene:AT5G16130 / 831470 AraportID:AT5G16130 Length:190 Species:Arabidopsis thaliana


Alignment Length:186 Identity:92/186 - (49%)
Similarity:134/186 - (72%) Gaps:6/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKIIKPGGSDPDDFEKSIAQALVELE-ANSDLKPYLRDLHITRAREIEF-GSKKAVIIYVPIPQQ 67
            :||.|...::|.:.|:.:||||.:|| .|.:||..|:||:|.:|..::. |::|||:||||...:
plant     6 NKIKKDKNAEPTECEEQVAQALFDLENTNQELKSELKDLYINQAVHMDISGNRKAVVIYVPFRLR 70

  Fly    68 KVFQKIQIILVRELEKKFSGKHVVVIAERKILPKPTRKARNPLKQKRPRSRTLTAVYDAILEDLV 132
            |.|:||...||||||||||||.|:.:..|:|:..|.:.|    ..:|||:||||:|::|:|||:.
plant    71 KAFRKIHPRLVRELEKKFSGKDVIFVTTRRIMRPPKKGA----AVQRPRNRTLTSVHEAMLEDVA 131

  Fly   133 FPAEIVGKRIRVKLDGSQLVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFP 188
            |||||||||.|.:||||:::||.||..::...|:|::|...||:||||:||.||:|
plant   132 FPAEIVGKRTRYRLDGSKIMKVFLDAKEKNNTEYKLETMVGVYRKLTGKDVVFEYP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS7NP_651782.1 Ribosomal_S7e 6..189 CDD:396003 92/185 (50%)
AT5G16130NP_197117.1 Ribosomal_S7e 7..188 CDD:396003 92/185 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 176 1.000 Domainoid score I1085
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H107159
Inparanoid 1 1.050 176 1.000 Inparanoid score I1481
OMA 1 1.010 - - QHG53491
OrthoDB 1 1.010 - - D1289550at2759
OrthoFinder 1 1.000 - - FOG0003109
OrthoInspector 1 1.000 - - otm3284
orthoMCL 1 0.900 - - OOG6_101127
Panther 1 1.100 - - O PTHR11278
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2081
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.