DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS7 and rps-7

DIOPT Version :9

Sequence 1:NP_651782.1 Gene:RpS7 / 43594 FlyBaseID:FBgn0039757 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_492708.1 Gene:rps-7 / 172901 WormBaseID:WBGene00004476 Length:194 Species:Caenorhabditis elegans


Alignment Length:186 Identity:110/186 - (59%)
Similarity:147/186 - (79%) Gaps:3/186 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIIKPGGSDPDDFEKSIAQALVELEANSDLKPYLRDLHITRAREIEFGSKKAVIIYVPIPQQKVF 70
            |::|..|....:.||.::|||::||.|.|::..|::|:|...:|:|.|:|.|:|||||:||.|.|
 Worm     7 KLLKSDGKVVSEIEKQVSQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAIIIYVPVPQLKAF 71

  Fly    71 QKIQIILVRELEKKFSGKHVVVIAERKILPKPTR--KARNPLKQKRPRSRTLTAVYDAILEDLVF 133
            .||...|||||||||.|:.::::|:|:|||||.|  ||| |.|||||||||||||:||.|::||:
 Worm    72 HKIHPALVRELEKKFGGRDILILAKRRILPKPQRGSKAR-PQKQKRPRSRTLTAVHDAWLDELVY 135

  Fly   134 PAEIVGKRIRVKLDGSQLVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFPD 189
            |||:||:||||||||.::.||||||:.||.:.||:..|.|||:||||:||||||||
 Worm   136 PAEVVGRRIRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKLTGKDVTFEFPD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS7NP_651782.1 Ribosomal_S7e 6..189 CDD:396003 108/184 (59%)
rps-7NP_492708.1 Ribosomal_S7e 14..191 CDD:279576 105/177 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158533
Domainoid 1 1.000 224 1.000 Domainoid score I1456
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H107159
Inparanoid 1 1.050 228 1.000 Inparanoid score I2216
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53491
OrthoDB 1 1.010 - - D1289550at2759
OrthoFinder 1 1.000 - - FOG0003109
OrthoInspector 1 1.000 - - oto18977
orthoMCL 1 0.900 - - OOG6_101127
Panther 1 1.100 - - LDO PTHR11278
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1249
SonicParanoid 1 1.000 - - X2081
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.