DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS7 and LOC100362830

DIOPT Version :9

Sequence 1:NP_651782.1 Gene:RpS7 / 43594 FlyBaseID:FBgn0039757 Length:194 Species:Drosophila melanogaster
Sequence 2:XP_002729622.2 Gene:LOC100362830 / 100362830 RGDID:2323948 Length:194 Species:Rattus norvegicus


Alignment Length:186 Identity:137/186 - (73%)
Similarity:162/186 - (87%) Gaps:1/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKIIKPGGSDPDDFEKSIAQALVELEANSDLKPYLRDLHITRAREIEF-GSKKAVIIYVPIPQQK 68
            :||:||.|..||:||..|:|||:|||.|||||..||:|:||.|:|||. |.:||:||:||:||.|
  Rat     6 AKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKEIEVGGGRKAIIIFVPVPQLK 70

  Fly    69 VFQKIQIILVRELEKKFSGKHVVVIAERKILPKPTRKARNPLKQKRPRSRTLTAVYDAILEDLVF 133
            .|||||:.|||||||||||||||.||:|:||||||||:|...|||||||||||||:|||||||||
  Rat    71 SFQKIQVRLVRELEKKFSGKHVVFIAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVF 135

  Fly   134 PAEIVGKRIRVKLDGSQLVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFPD 189
            |:||||||||||||||:|:||||||.||..:||||:||:.|||||||:||.||||:
  Rat   136 PSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS7NP_651782.1 Ribosomal_S7e 6..189 CDD:396003 136/183 (74%)
LOC100362830XP_002729622.2 Ribosomal_S7e 7..191 CDD:396003 136/183 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 273 1.000 Domainoid score I1715
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H107159
Inparanoid 1 1.050 274 1.000 Inparanoid score I2892
OMA 1 1.010 - - QHG53491
OrthoDB 1 1.010 - - D1289550at2759
OrthoFinder 1 1.000 - - FOG0003109
OrthoInspector 1 1.000 - - oto97201
orthoMCL 1 0.900 - - OOG6_101127
Panther 1 1.100 - - LDO PTHR11278
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2081
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.