DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9743 and ADS2

DIOPT Version :9

Sequence 1:NP_651781.1 Gene:CG9743 / 43593 FlyBaseID:FBgn0039756 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001323798.1 Gene:ADS2 / 817694 AraportID:AT2G31360 Length:307 Species:Arabidopsis thaliana


Alignment Length:310 Identity:81/310 - (26%)
Similarity:144/310 - (46%) Gaps:63/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VEEEEEYHPQI-----------------RWPDLGAQAFLHIGALYGLYQL-FYANFY---TFLWV 134
            |||..:.:|..                 ||..|.   ::...|.:.::.| ..|.||   :.|||
plant     7 VEENHQKNPSTPAAVEEKKKRRWVFWDRRWRRLD---YVKFSASFTVHSLALLAPFYFTWSALWV 68

  Fly   135 VVTVW-VSGIGITAGAHRLWSHKSYTASLPLRILLAFAFSIAGQRDAYTWALDHRIHHKFSETDA 198
            ....: :.|:|||...||..:|:|:.....|..|||:...:|.|.|...|...||.||:|::::.
plant    69 TFLFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVSTHRYHHQFTDSER 133

  Fly   199 DPHNAKRGFFFAHVGWLFLTPHPKVVAK--RKVIDMSDLEADAVCMFQRKYYIPLFALCSIILPV 261
            |||:.|.||:|:|:.|::.:.:  :|:|  |:. ::.||:......|.:|         :::..:
plant   134 DPHSPKEGFWFSHLLWIYDSAY--LVSKCGRRA-NVEDLKRQWFYRFLQK---------TVLFHI 186

  Fly   262 AVPWYFWNEDLWMSFWINF--NMRF-TW--------TLNVAFFVNSVAHMYGNKPYDKNLMSTEA 315
                      |.:.|::.:  .|.| ||        .::|...:||:.|::|.:.:..|..|...
plant   187 ----------LGLGFFLFYLGGMSFVTWGMGVGAALEVHVTCLINSLCHIWGTRTWKTNDTSRNV 241

  Fly   316 PIVSLLAMGEGWHNYHHVFPWDYKTG-EFGNYSLNITTGFIDFCAWLGLA 364
            ..:|:.:.||.|||.||.|....:.| |:  :.::|:...:.|...:|||
plant   242 WWLSVFSFGESWHNNHHAFESSARQGLEW--WQIDISWYIVRFFEIIGLA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9743NP_651781.1 Delta9-FADS-like 130..368 CDD:239582 69/250 (28%)
FA_desaturase 131..335 CDD:278890 61/217 (28%)
ADS2NP_001323798.1 PLN02220 1..307 CDD:177866 81/310 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.