DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and OLE1

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_011460.3 Gene:OLE1 / 852825 SGDID:S000003023 Length:510 Species:Saccharomyces cerevisiae


Alignment Length:341 Identity:78/341 - (22%)
Similarity:146/341 - (42%) Gaps:47/341 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KEPDQSGDSIHKKRDAIWPLVLFYIHLNILG--------VYGIYVLLTS---ASWATILFTALLT 60
            :|.:::...||..... |.|..::.|||.|.        :.|.|..|:.   ......||:....
Yeast    86 QEKEEAKTKIHISEQP-WTLNNWHQHLNWLNMVLVCGMPMIGWYFALSGKVPLHLNVFLFSVFYY 149

  Fly    61 LLGTLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYS 125
            .:|.:.:|.|.||||:||:::|..||::|.......:.:||......:||:||.......|||.:
Yeast   150 AVGGVSITAGYHRLWSHRSYSAHWPLRLFYAIFGCASVEGSAKWWGHSHRIHHRYTDTLRDPYDA 214

  Fly   126 KHSFMYAQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYF 190
            :....|:.:...|||.:|:.:   ...|::|:..|..:.||.|.|:||.:....::.......:|
Yeast   215 RRGLWYSHMGWMLLKPNPKYK---ARADITDMTDDWTIRFQHRHYILLMLLTAFVIPTLICGYFF 276

  Fly   191 GDSLATSMFVGFWLRSLIVINLGNLVHS-SHFIWSIHKGFKPTDS---------NSIFLITKSYW 245
            .|.:...::.|| :|..::......::| :|:|     |.:|.|.         .:|....:.| 
Yeast   277 NDYMGGLIYAGF-IRVFVIQQATFCINSLAHYI-----GTQPFDDRRTPRDNWITAIVTFGEGY- 334

  Fly   246 PQYHYLLPRDYQSG-EYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETGRPIVE 309
            ..:|:..|.||::. ::..|..  ...:|.:.:.:..|.|||.....|:.:.|.:          
Yeast   335 HNFHHEFPTDYRNAIKWYQYDP--TKVIIYLTSLVGLAYDLKKFSQNAIEEALIQ---------- 387

  Fly   310 CIEEQVELEENALPAN 325
              :||.::.:.....|
Yeast   388 --QEQKKINKKKAKIN 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 59/247 (24%)
OLE1NP_011460.3 OLE1 92..385 CDD:224316 73/305 (24%)
CYB5 <408..510 CDD:227599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
TreeFam 1 0.960 - -
65.720

Return to query results.
Submit another query.