DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and Scd2

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_114029.1 Gene:Scd2 / 83792 RGDID:621177 Length:358 Species:Rattus norvegicus


Alignment Length:307 Identity:96/307 - (31%)
Similarity:155/307 - (50%) Gaps:27/307 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLLGTLGVTVGVHRL 74
            |:.|..  .|.:.:|..::....|:|..:||| .|:.|....|.||..|..::..||:|.|.|||
  Rat    60 DEEGPP--PKLEYVWRNIILMALLHIGALYGI-TLVPSCKVYTCLFAYLYYVISALGITAGAHRL 121

  Fly    75 WAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQVRGGLL 139
            |:|||:.|..||::||:...|.|.|..:|...:.||.||...:...||:.|:..|.::.|...|:
  Rat   122 WSHRTYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLV 186

  Fly   140 KYSPQQEELLKDVDMSDLESDPVVMFQKRFY---VLLYIFLNVLLSVNTPFQYFGDSLATSMFVG 201
            :..|..:|....:|||||:::.:||||:|:|   :||..|   :|....|:..:|::...|:.|.
  Rat   187 RKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCF---ILPTLVPWYCWGETFVNSLCVS 248

  Fly   202 FWLRSLIVINLGNLVHSSHFIWSIHKGFKPTDSN---------SIFLITKSYWPQYHYLLPRDYQ 257
            .:||..:|:|...||:|:..::    |::|.|.|         |:..:.:.: ..||:..|.||.
  Rat   249 TFLRYAVVLNATWLVNSAAHLY----GYRPYDKNISSRENILVSMGAVGEGF-HNYHHAFPYDYS 308

  Fly   258 SGEYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETG 304
            :.|| .:.....:..|...|.|..|.|.|.:...||   |.:...||
  Rat   309 ASEY-RWHINFTTFFIDCMALLGLAYDRKRVSKAAV---LARIKRTG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 79/248 (32%)
Scd2NP_114029.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..43
Delta9-FADS-like 99..336 CDD:239582 79/245 (32%)
FA_desaturase 101..305 CDD:278890 68/211 (32%)
Histidine box-1. /evidence=ECO:0000305 119..124 4/4 (100%)
Histidine box-2. /evidence=ECO:0000305 156..160 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 297..301 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.