DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and AT1G06360

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001320561.1 Gene:AT1G06360 / 837147 AraportID:AT1G06360 Length:315 Species:Arabidopsis thaliana


Alignment Length:297 Identity:75/297 - (25%)
Similarity:120/297 - (40%) Gaps:52/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KRDAIWPLVLFYIH-----------LNILGVYGIYVLLT-SASWATILFTALLTLLGTLGVTVGV 71
            ||.|:......|||           |.::.|:.:.:|.. :..|..:.|..:|..|.:|.:|...
plant    28 KRGAVSKEKRPYIHREWSWADIIRALTVINVHFLCLLAPFNYKWEALRFGFVLYALTSLSITFSY 92

  Fly    72 HRLWAHRTFTASK----PLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYA 132
            ||..|||:|...|    ||..|.:|    |.||.....|..||.||.....|.||:.....|.::
plant    93 HRNLAHRSFKLPKWLEYPLAYFAVF----ALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFS 153

  Fly   133 QV----RGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFY--VLLYIFLNVLLSVNTPFQYFG 191
            .|    ....:||.......:.|:.            |:.||  :.:.|..:||:.....:.|.|
plant   154 HVWWICDTRYIKYKCGGRNNVMDLK------------QQWFYWFLRMTIGFHVLMFWTVLYLYGG 206

  Fly   192 DSLATSMFVGFWLRSLIVINLGNLVHSSHFIWSIHKGFKPTDSN------SIFLITKSYWPQYHY 250
            ....|   .|..:..:|..::..||:|:..||. .:.:|..|::      |:|.:.:| |...|:
plant   207 LPYLT---CGGGVGGVIGYHVTWLVNSACHIWG-SRSWKTKDTSRNVWWLSLFTMGES-WHNNHH 266

  Fly   251 LLPRDYQSG-EYGNYASGIGSSMIRVFAALDWAKDLK 286
            ......:.| |:  :...|...:||:|..|..|.|:|
plant   267 AFESSARQGLEW--WQIDITWYLIRLFEVLGLATDVK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 65/253 (26%)
AT1G06360NP_001320561.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.