DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and AT1G06120

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_172102.1 Gene:AT1G06120 / 837121 AraportID:AT1G06120 Length:299 Species:Arabidopsis thaliana


Alignment Length:306 Identity:66/306 - (21%)
Similarity:115/306 - (37%) Gaps:50/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KEPDQSGD---SIHKKRDAI----WPLVLFYIHLNILGVYGIYVLLT--SASWATILFTALLTLL 62
            |..|.|..   ::.|::.|.    |..| ..:.::.:|...:..||.  :.:|....|.|::.:.
plant     4 KNKDDSSSQSKAVRKEKRAFLFRKWTRV-DVMRVSAVGAVHLLCLLAPFNYTWEAFRFAAMVGIS 67

  Fly    63 GTLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKH 127
            ..|.:|...||...||:|...|.|:....:....|.||.....|..||.||.....|.||:....
plant    68 TNLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQFTDSDRDPHSPIE 132

  Fly   128 SFMYAQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKR--------FYVLLYIFLNVLLSVN 184
            .|.::.| ..:...|..:|:.....::.||:......|.:.        |::|:|::..:     
plant   133 GFWFSHV-FWIFDTSYIREKCGGRDNVMDLKQQWFYRFLQNTIGLHILTFWILVYLWGGL----- 191

  Fly   185 TPFQYFGDSLATSMFVGF---WLRSLIVINLGNLVHSSHFIWSIHKGFKPTDSNSI-----FLIT 241
               .|...|:.....:|:   |           |::|:..||..........|.:|     |.:.
plant   192 ---PYLTWSVGVGGAIGYHATW-----------LINSACHIWGSRAWNTKDTSRNIWWLGPFTMG 242

  Fly   242 KSYWPQYHYLLPRDYQSG-EYGNYASGIGSSMIRVFAALDWAKDLK 286
            :| |...|:......:.| |:  |...:...:|..|..|..|.|:|
plant   243 ES-WHNNHHAFEASARHGLEW--YQVDLTWYLIWFFQVLGLATDVK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 55/253 (22%)
AT1G06120NP_172102.1 PLN02220 1..299 CDD:177866 66/306 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.