DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and AT1G06100

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_172100.1 Gene:AT1G06100 / 837119 AraportID:AT1G06100 Length:299 Species:Arabidopsis thaliana


Alignment Length:261 Identity:58/261 - (22%)
Similarity:94/261 - (36%) Gaps:56/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ETTKVKEPDQSGDSIHKKRDAIWPLVLFYI----------HLNILGVYGIYVLLT--SASWATIL 54
            ||||.....|. .|:.|::.|       |:          ..:.:|...:..||.  :..|....
plant     3 ETTKDDGSSQK-KSVRKEKRA-------YVLRKWTQFDVGRASTVGTVHLLCLLAPFNYKWEAFR 59

  Fly    55 FTALLTLLGTLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQD 119
            |..:|.:|..|.:|...||...||:|...|.|:....:....|.||.....|..||.||.....|
plant    60 FGIILAILTNLCITFSYHRNLTHRSFKLPKWLEYPFAYSALLALQGDPLDWVSIHRFHHQFTDSD 124

  Fly   120 EDPYYSKHSFMYAQVRGGLLKYSPQ--QEELLKDVDMSDLESDPVVMFQKR--------FYVLLY 174
            .||:.....|.::.|   |..:...  :|:..:..::.||:......|.|:        |:.|:|
plant   125 RDPHSPIEGFWFSHV---LWIFDTDYIREKCGRRNNVMDLKQQWFYRFLKKTLVLHILAFWTLIY 186

  Fly   175 I-----FLNVLLSVNTPFQYFGDSLATSM--FVG-------------FWLRSLIVINLGNLVHSS 219
            :     :|...:.......|.|..|..|.  ..|             :|   |.::.:|...|::
plant   187 LWGGLPYLTWTVGFGGVIGYHGTWLVNSACHICGSQAWQTNDTSRNVWW---LALLTMGESWHNN 248

  Fly   220 H 220
            |
plant   249 H 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 46/202 (23%)
AT1G06100NP_172100.1 PLN02220 1..299 CDD:177866 58/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.