DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and AT1G06090

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_172099.1 Gene:AT1G06090 / 837118 AraportID:AT1G06090 Length:299 Species:Arabidopsis thaliana


Alignment Length:268 Identity:60/268 - (22%)
Similarity:103/268 - (38%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LGVYGIYVLLT--SASWATILFTALLTLLGTLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAG 98
            :|...:..||.  :..|..:.|..:|.::.:|.:|...||...|::|...|.|:....:....|.
plant    39 VGAVHLLCLLAPFNYKWEALRFGVILAIVTSLSITFSYHRNLTHKSFKLPKWLEYPFAYSALFAL 103

  Fly    99 QGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQVRGGLLKYSPQQEELLKDVDMSDLESDPVV 163
            ||.....|..||.||.....|.||:.....|.::.| ..:...|..:|:.....::.||:.....
plant   104 QGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHV-FWIFDTSYIREKCGGRDNVMDLKQQWFY 167

  Fly   164 MFQKR--------FYVLLYIFLNVLLSVNTPFQYFGDSL-ATSMFVGFWLRSLIVINLGNLVHSS 219
            .|.:.        |:.|:|::..:      |:...|..: .|..:.|.|           |::|:
plant   168 RFLRNTIGLHILTFWTLVYLWGGL------PYLTCGVGVGGTIGYNGTW-----------LINSA 215

  Fly   220 HFIWSIHKGFKPTDSNSI-----FLITKSYWPQYHYLLPRDYQSG-EYGNYASGIGSSMIRVFAA 278
            ..||..........|.:|     |.:.:| |...|:......:.| |:  |...:...:|..|.|
plant   216 CHIWGSRAWNTKDTSRNIWWLGPFTMGES-WHNNHHAFEASARHGLEW--YQVDLTWYLICFFQA 277

  Fly   279 LDWAKDLK 286
            |..|.|:|
plant   278 LGLATDVK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 56/251 (22%)
AT1G06090NP_172099.1 PLN02220 1..299 CDD:177866 60/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.