DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and ADS1

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_172098.1 Gene:ADS1 / 837117 AraportID:AT1G06080 Length:305 Species:Arabidopsis thaliana


Alignment Length:287 Identity:66/287 - (22%)
Similarity:116/287 - (40%) Gaps:48/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KKRDAIWPLVLFYIH-LNILGVYGIYVLLTSASWATILFTALLTLLGTLGVTVGVHRLWAHRTFT 81
            |:.|.:......::| |.:|..:..       :|..:....::..:|.||:||..||..|||:|.
plant    35 KRLDIVKAFASLFVHFLCLLAPFNF-------TWPALRVALIVYTVGGLGITVSYHRNLAHRSFK 92

  Fly    82 ASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQV-----RGGLLKY 141
            ..|.|:.|..:|...|.||.....|..||.||.....|.||:.....|.::.:     .|.|:  
plant    93 VPKWLEYFFAYCGLLAIQGDPIDWVSTHRYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLV-- 155

  Fly   142 SPQQEELLKDVDMSDLESDPVVMFQKR---FYVLLYIFLNVLLSVNTPFQYFG--DSLATSMFVG 201
                |:..:..::.||:......|.:|   :::|.:.||         ..|||  ..|...|.:|
plant   156 ----EKCGRRTNVEDLKRQWYYKFLQRTVLYHILTFGFL---------LYYFGGLSFLTWGMGIG 207

  Fly   202 FWLRSLIVINLGNLVHSSHFIWSIHKGFKPTDSN------SIFLITKSYWPQYHYLLPRDYQSG- 259
            ..:...:...:.:|.|    :|. .:.:|..|::      |:|...:| |...|:......:.| 
plant   208 VAMEHHVTCLINSLCH----VWG-SRTWKTNDTSRNVWWLSVFSFGES-WHNNHHAFESSARQGL 266

  Fly   260 EYGNYASGIGSSMIRVFAALDWAKDLK 286
            |:  :...|...::|....:..|.|:|
plant   267 EW--WQIDISWYIVRFLEIIGLATDVK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 60/253 (24%)
ADS1NP_172098.1 PLN02220 1..305 CDD:177866 66/287 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.