DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and AT3G15870

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_188208.4 Gene:AT3G15870 / 820830 AraportID:AT3G15870 Length:361 Species:Arabidopsis thaliana


Alignment Length:235 Identity:51/235 - (21%)
Similarity:94/235 - (40%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLLGTLGVTVGVHRLWAHRTFTASKPLKVFL 90
            ||:| :..::|.:...:.....|.|   :|..|:.:.| :.:|:..||..:||:|...|.|:...
plant    99 LVIF-VGTHLLSLLAPFYFSWEAFW---VFPWLVFING-ICITLSYHRNLSHRSFDLPKWLEYLF 158

  Fly    91 MFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQVRGGLLKYSPQQEELLKDVDMS 155
            .:....|.||.....|..||.||...:...||:.....|.::.: ..:...|...|....:.::.
plant   159 AYGGVLAFQGDPIEWVSNHRYHHKHCETQRDPHSPTQGFWFSHM-AWIFDTSSILENCGGEENVD 222

  Fly   156 DLESDPVVMFQKR---FYVLLYIFL--------------NVLLSVNTPFQYFGDSLA-------- 195
            ||...|...|.:|   .:::.|.||              .:.::|.....:..:|:.        
plant   223 DLVRQPFYRFLQRTVLLHMMAYSFLFYFCGGMPLLVWGIGITIAVRLHLTFLVNSVCHIWGTRAW 287

  Fly   196 -TSMFV--GFWLRSLIVINLGNLVHSSH--FIWSIHKGFK 230
             ||.|.  .:|   :.::.||...|::|  |.:|...|.:
plant   288 NTSDFSKNNWW---VAILTLGEGWHNNHHAFEFSARHGLE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 46/212 (22%)
AT3G15870NP_188208.4 Membrane-FADS-like 78..361 CDD:294412 51/235 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.