DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and LOC681458

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_008758709.3 Gene:LOC681458 / 681458 RGDID:1595370 Length:350 Species:Rattus norvegicus


Alignment Length:310 Identity:92/310 - (29%)
Similarity:156/310 - (50%) Gaps:33/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLLGTLGVTVGVHRL 74
            |:.|..  .|.:.:|..::....|::..:||| .|:.|:...|:|:..:...:...|:..|||||
  Rat    52 DEEGPP--PKLEYVWRNIILMALLHVGALYGI-TLIPSSKVYTLLWAFIYYAISIEGIGAGVHRL 113

  Fly    75 WAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQVRGGLL 139
            |:|||:.|..||::||:...|.|.|..:|...:.||.||...:...||:.|:..|.::.|...|:
  Rat   114 WSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFTETHADPHNSRRGFFFSHVGWLLV 178

  Fly   140 KYSPQQEELLKDVDMSDLESDPVVMFQKRFY---VLLYIFLNVLLSVNTPFQYFGDSLATSMFVG 201
            :..|..:|....:|||||:::.:||||:|:|   :||..|   :|....|:.::|::...|.:|.
  Rat   179 RKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGILLLCF---ILPTLVPWYFWGETFLHSFYVA 240

  Fly   202 FWLRSLIVINLGNLVHSSHFIWSIHKGFKPTDSN---------SIFLITKSYWPQYHYLLPRDYQ 257
            ..||..:|:|:..||:|:..::    |::|.|.|         |:..:.:.: ..||:..|.||.
  Rat   241 TLLRYAVVLNVTWLVNSAAHLY----GYRPYDKNIDPRENALVSLGTLGEGF-HNYHHAFPYDYS 300

  Fly   258 SGEYG---NYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETG 304
            :.||.   |:.    :..|...|.|..|.|.|.:....|   |.:...||
  Rat   301 ASEYPWHINFT----TFFIDCMAFLGLAYDRKRVSKATV---LARIKRTG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 77/251 (31%)
LOC681458XP_008758709.3 Delta9-FADS-like 91..328 CDD:239582 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.