DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and SCD

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_005054.3 Gene:SCD / 6319 HGNCID:10571 Length:359 Species:Homo sapiens


Alignment Length:304 Identity:90/304 - (29%)
Similarity:156/304 - (51%) Gaps:21/304 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLLGTLGVTVGVHRL 74
            |:.|.|  .|.:.:|..::....|::..:||| .|:.:..:.|.|:......:..||:|.|.|||
Human    61 DKEGPS--PKVEYVWRNIILMSLLHLGALYGI-TLIPTCKFYTWLWGVFYYFVSALGITAGAHRL 122

  Fly    75 WAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQVRGGLL 139
            |:||::.|..||::||:...|.|.|..:|...:.||.||...:...||:.|:..|.::.|...|:
Human   123 WSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLV 187

  Fly   140 KYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGDSLATSMFVGFWL 204
            :..|..:|....:|:||||::.:||||:|:|....:.:..:|....|:.::|::...|:||..:|
Human   188 RKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSVFVATFL 252

  Fly   205 RSLIVINLGNLVHSSHFIWSIHKGFKPTDSN---------SIFLITKSYWPQYHYLLPRDYQSGE 260
            |..:|:|...||:|:..::    |::|.|.|         |:..:.:.: ..||:..|.||.:.|
Human   253 RYAVVLNATWLVNSAAHLF----GYRPYDKNISPRENILVSLGAVGEGF-HNYHHSFPYDYSASE 312

  Fly   261 YGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETG 304
            | .:.....:..|...|||..|.|.|.:...|:   |.:...||
Human   313 Y-RWHINFTTFFIDCMAALGLAYDRKKVSKAAI---LARIKRTG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 75/245 (31%)
SCDNP_005054.3 Delta9-FADS-like 100..337 CDD:239582 75/242 (31%)
FA_desaturase 102..306 CDD:278890 63/208 (30%)
Histidine box-1. /evidence=ECO:0000305 120..125 4/4 (100%)
Histidine box-2. /evidence=ECO:0000305 157..161 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 298..302 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.