DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and Desat2

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_650201.1 Gene:Desat2 / 41536 FlyBaseID:FBgn0043043 Length:361 Species:Drosophila melanogaster


Alignment Length:310 Identity:101/310 - (32%)
Similarity:168/310 - (54%) Gaps:23/310 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DQSGDSIHKKR------DAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLLGTLGVT 68
            |.:.|....||      ..:|..::.:..:::..:||::.:.|.|..||.||.|.|.::|.||||
  Fly    31 DLTTDRFQLKRAEKRRLPLVWRNIILFALVHLAALYGLHSIFTRAKLATTLFAAGLYIIGMLGVT 95

  Fly    69 VGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQ 133
            .|.||||||||:.|..||::.|:...|.|.|.::|...:.||:||...:.|.||:.:...|.::.
  Fly    96 AGAHRLWAHRTYKAKWPLRLLLVIFNTIAFQDAVYHWARDHRVHHKYSETDADPHNATRGFFFSH 160

  Fly   134 VRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGDSLATSM 198
            |...|.|..|..:|..:.:|:|||.:||::|||::.|.:|......:|....|..|:.::||:|.
  Fly   161 VGWLLCKKHPDIKEKGRGLDLSDLRADPILMFQRKHYYILMPLACFVLPTVIPMVYWNETLASSW 225

  Fly   199 FVGFWLRSLIVINLGNLVHSSHFIWSIHK-GFKPTD-----SNSIFLITKSY---WPQYHYLLPR 254
            ||....|....:|:..||:|     :.|| |.:|.|     :.:.|:...::   |..||:..|.
  Fly   226 FVATMFRWCFQLNMTWLVNS-----AAHKFGNRPYDKTMNPTQNAFVSAFTFGEGWHNYHHAFPW 285

  Fly   255 DYQSGEYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETG 304
            ||::.|:|.|:..|.::.|.:||.:.||.||||:....:::   :.:.||
  Fly   286 DYKTAEWGCYSLNITTAFIDLFAKIGWAYDLKTVAPDVIQR---RVLRTG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 87/245 (36%)
Desat2NP_650201.1 Delta9-FADS-like 76..317 CDD:239582 87/245 (36%)
FA_desaturase 81..284 CDD:278890 72/207 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
98.920

Return to query results.
Submit another query.