DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and Scd4

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_899039.2 Gene:Scd4 / 329065 MGIID:2670997 Length:353 Species:Mus musculus


Alignment Length:303 Identity:92/303 - (30%)
Similarity:153/303 - (50%) Gaps:19/303 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLLGTLGVTVGVHRL 74
            |:.|..  .|.:.:|..::|...|::..:||| .|:.|....|.|......::..||:|.|.|||
Mouse    55 DEEGPP--PKLEYVWRNIIFMALLHVGALYGI-TLVPSCKVYTWLLGVFYNVVAGLGITAGAHRL 116

  Fly    75 WAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFMYAQVRGGLL 139
            |:|||:.|..||::||:...|.|.|..:|...:.||.||...:...||:.|:..|.::.|...|:
Mouse   117 WSHRTYKARLPLRIFLIMANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLV 181

  Fly   140 KYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGDSLATSMFVGFWL 204
            :..|..:|..|::|||||:::.:||||:|:|.|....:.::|....|:..:|::...|:.|..:|
Mouse   182 RKHPAVKEKGKNLDMSDLKAEKLVMFQRRYYKLAVTLMFIILPTLVPWYLWGETFQHSLCVSNFL 246

  Fly   205 RSLIVINLGNLVHSSHFIWSIHKGFKPTD-----SNSIFLITKSY---WPQYHYLLPRDYQSGEY 261
            |..:::|...||:|:..::    |::|.|     ..:.|:...|.   :..||:..|.||...||
Mouse   247 RYAVLLNFTWLVNSAAHLY----GYRPYDRGIGARENPFVSMASLGEGFHNYHHTFPYDYSVSEY 307

  Fly   262 GNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETG 304
             .:.....:..|...|||..|.|.|.:....|   |.:...||
Mouse   308 -RWHINFTTFFIDCMAALGLAYDRKKVSKAVV---LARIKRTG 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 76/244 (31%)
Scd4NP_899039.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Delta9-FADS-like 94..331 CDD:239582 76/241 (32%)
FA_desaturase 94..300 CDD:278890 65/209 (31%)
Histidine box-1. /evidence=ECO:0000305 114..119 4/4 (100%)
Histidine box-2. /evidence=ECO:0000305 151..155 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 292..296 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.