DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and SPCC1281.06c

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_588170.1 Gene:SPCC1281.06c / 2538753 PomBaseID:SPCC1281.06c Length:479 Species:Schizosaccharomyces pombe


Alignment Length:321 Identity:88/321 - (27%)
Similarity:144/321 - (44%) Gaps:50/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PDQSGDSIHKK--RDAIWPLVLFYIHLN-----------ILGVYGIYVLLTSASWATILFTALLT 60
            |::..|....|  ::..|.:..::.|||           ::.:||::.  |.....|::|..:..
pombe    36 PERKWDPKAPKHIQEQPWTMQNWWRHLNWLHCMLIFGLPMIAIYGVFT--TPLQTKTLIFAIIYY 98

  Fly    61 LLGTLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYS 125
            ....||:|.|.||||:||.:.|.|||:.||......|.:|||....:.||.||.....|:|||..
pombe    99 AYSGLGITAGYHRLWSHRAYKAKKPLEYFLAAGGAAAFEGSIRWWSRDHRAHHRYTDTDKDPYNV 163

  Fly   126 KHSFMYAQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYV-----LLYIFLNVLLSVNT 185
            |..|.||.|...::..:|::   :...|:|||.|||.|||..|.::     :.:||.::...:  
pombe   164 KKGFWYAHVGWMIILQNPRR---IGRSDVSDLNSDPFVMFNHRHFLPIASFMAFIFPSLFCGL-- 223

  Fly   186 PFQYFGDSLATSMFVGFWLRSLIVINLGNLVHS-SHFIWSIHKGFKPTDSNSIFLITKSYW---- 245
               .:||......:.|. .|.:.|.:....|:| :|.|.|  :.|..|:|.....||....    
pombe   224 ---LWGDYRGGYFYAGV-CRLVFVHHATFCVNSLAHLIGS--QPFDDTNSARNHFITALVTLGEG 282

  Fly   246 -PQYHYLLPRDYQSG----EYGNYASGIGSSMIRVFAA--LDWAKDLKTIGSVAVRQGLTK 299
             ..||:..|.||::|    ||       ..:.|.::.|  ...|.:|.|.....:::|:.:
pombe   283 NHNYHHAFPNDYRNGLRWYEY-------DPTKIFIYIASLFGLAYNLNTFPDNEIQKGIVQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 75/253 (30%)
SPCC1281.06cNP_588170.1 OLE1 43..334 CDD:224316 85/310 (27%)
FA_desaturase 91..304 CDD:278890 71/230 (31%)
CYB5 345..474 CDD:227599
Cyt-b5 360..432 CDD:278597
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.