DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15531 and fat-6

DIOPT Version :9

Sequence 1:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001255595.1 Gene:fat-6 / 178122 WormBaseID:WBGene00001398 Length:339 Species:Caenorhabditis elegans


Alignment Length:329 Identity:93/329 - (28%)
Similarity:152/329 - (46%) Gaps:36/329 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METTKVKEPDQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTALLTLLGTL 65
            ::..::.:..:....|..|.:.:|..|..:..|:.....|:|.|:..|.|.|::||.||.:.|..
 Worm    26 VDPNEIIQLQEESKKIPYKMEIVWRNVALFAALHFAAAIGLYQLIFEAKWQTVIFTFLLYVFGGF 90

  Fly    66 GVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHSFM 130
            |:|.|.||||:|:::.|:.|:::|||.....|.|..:....:.||.||.....|.||:.:...|.
 Worm    91 GITAGAHRLWSHKSYKATTPMRIFLMILNNIALQNDVIEWARDHRCHHKWTDTDADPHNTTRGFF 155

  Fly   131 YAQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGDSLA 195
            :|.:...|::..||.:|....:|||||.||||::||::.|..|.|....:|....|. ||....|
 Worm   156 FAHMGWLLVRKHPQVKEQGAKLDMSDLLSDPVLVFQRKHYFPLVILCCFILPTIIPV-YFWKETA 219

  Fly   196 TSMFVGFWLRSLIVINLGNLVHSSHFIWSIHK-----GFKPTDSN-----SIFLITKSYWP---Q 247
               |:.|:.....     ....:.|..|.|:.     |:||.||:     ::|....:...   .
 Worm   220 ---FIAFYTAGTF-----RYCFTLHATWCINSAAHYFGWKPYDSSITPVENVFTTIAAVGEGGHN 276

  Fly   248 YHYLLPRDYQSGEYG---NYASGIGSSMIRVFAALDWAKDLKT-----IGSVAVRQGLTKAVETG 304
            :|:..|:||::.||.   |:.    ..:|...|||....|.||     ||......|..  ::.|
 Worm   277 FHHTFPQDYRTSEYSLKYNWT----RVLIDTAAALGLVYDRKTACDEIIGRQVSNHGCD--IQRG 335

  Fly   305 RPIV 308
            :.|:
 Worm   336 KSIM 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 77/252 (31%)
fat-6NP_001255595.1 Delta9-FADS-like 74..314 CDD:239582 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.