DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9747 and OLE1

DIOPT Version :9

Sequence 1:NP_001287604.1 Gene:CG9747 / 43591 FlyBaseID:FBgn0039754 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_011460.3 Gene:OLE1 / 852825 SGDID:S000003023 Length:510 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:88/293 - (30%)
Similarity:152/293 - (51%) Gaps:28/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GDRVLGWQFQAPLKWDKVIQISLLHIVAGICLLTYPLRELNPYTTIWSFFVGGVAGFGVTAGAHR 159
            |..::||.|....|                    .|| .||.:  ::|.|...|.|..:|||.||
Yeast   121 GMPMIGWYFALSGK--------------------VPL-HLNVF--LFSVFYYAVGGVSITAGYHR 162

  Fly   160 FWTHKSYKANTVLRSILMVCYCVAGQNTLYDWVRDHRVHHKYSETDADPHNANRGFFFSHVGWLM 224
            .|:|:||.|:..||....:..|.:.:.:...|...||:||:|::|..||::|.||.::||:||::
Yeast   163 LWSHRSYSAHWPLRLFYAIFGCASVEGSAKWWGHSHRIHHRYTDTLRDPYDARRGLWYSHMGWML 227

  Fly   225 MLKHPEVLRRGRQIDMSDILADPVVRFHQKYFIPLKTFFCFILPTVIPVYCWGETWTLAFIQQCL 289
            :..:|:...|.   |::|:..|..:||..:::|.|.....|::||:|..|.:.: :....|....
Yeast   228 LKPNPKYKARA---DITDMTDDWTIRFQHRHYILLMLLTAFVIPTLICGYFFND-YMGGLIYAGF 288

  Fly   290 FRYVSSLNFTWSVNSAAHLWGSRPYDKRIMPSENIYVSLLAMGEGWHNYHHVFPWDYKAAELGNY 354
            .|.......|:.:||.||..|::|:|.|..|.:|...:::..|||:||:||.||.||:.| :..|
Yeast   289 IRVFVIQQATFCINSLAHYIGTQPFDDRRTPRDNWITAIVTFGEGYHNFHHEFPTDYRNA-IKWY 352

  Fly   355 TVNFTTMVLDAFHKLGWAWNMKQPSKELVRRTL 387
            ..:.|.:::.....:|.|:::|:.|:..:...|
Yeast   353 QYDPTKVIIYLTSLVGLAYDLKKFSQNAIEEAL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9747NP_001287604.1 Delta9-FADS-like 135..376 CDD:239582 77/240 (32%)
FA_desaturase 140..343 CDD:278890 67/202 (33%)
OLE1NP_011460.3 OLE1 92..385 CDD:224316 87/291 (30%)
CYB5 <408..510 CDD:227599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I661
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I832
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - otm46538
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.