DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9747 and Scd2

DIOPT Version :9

Sequence 1:NP_001287604.1 Gene:CG9747 / 43591 FlyBaseID:FBgn0039754 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_114029.1 Gene:Scd2 / 83792 RGDID:621177 Length:358 Species:Rattus norvegicus


Alignment Length:286 Identity:138/286 - (48%)
Similarity:190/286 - (66%) Gaps:7/286 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 WDKVIQISLLHIVA--GICLLTYPLRELNPYTTIWSFFVGGVAGFGVTAGAHRFWTHKSYKANTV 171
            |..:|.::||||.|  ||.|:.    ....||.::::....::..|:||||||.|:|::|||...
  Rat    72 WRNIILMALLHIGALYGITLVP----SCKVYTCLFAYLYYVISALGITAGAHRLWSHRTYKARLP 132

  Fly   172 LRSILMVCYCVAGQNTLYDWVRDHRVHHKYSETDADPHNANRGFFFSHVGWLMMLKHPEVLRRGR 236
            ||..|::...:|.||.:|:|.||||.|||:|||.|||||:.|||||||||||::.|||.|..:|.
  Rat   133 LRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGG 197

  Fly   237 QIDMSDILADPVVRFHQKYFIPLKTFFCFILPTVIPVYCWGETWTLAFIQQCLFRYVSSLNFTWS 301
            ::||||:.|:.:|.|.::|:.|.....||||||::|.||||||:..:.......||...||.||.
  Rat   198 KLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFVNSLCVSTFLRYAVVLNATWL 262

  Fly   302 VNSAAHLWGSRPYDKRIMPSENIYVSLLAMGEGWHNYHHVFPWDYKAAELGNYTVNFTTMVLDAF 366
            |||||||:|.|||||.|...|||.||:.|:|||:|||||.||:||.|:|. .:.:||||..:|..
  Rat   263 VNSAAHLYGYRPYDKNISSRENILVSMGAVGEGFHNYHHAFPYDYSASEY-RWHINFTTFFIDCM 326

  Fly   367 HKLGWAWNMKQPSKELVRRTLEKYGD 392
            ..||.|::.|:.||..|...:::.|:
  Rat   327 ALLGLAYDRKRVSKAAVLARIKRTGE 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9747NP_001287604.1 Delta9-FADS-like 135..376 CDD:239582 123/240 (51%)
FA_desaturase 140..343 CDD:278890 107/202 (53%)
Scd2NP_114029.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..43
Delta9-FADS-like 99..336 CDD:239582 122/237 (51%)
FA_desaturase 101..305 CDD:278890 108/203 (53%)
Histidine box-1. /evidence=ECO:0000305 119..124 3/4 (75%)
Histidine box-2. /evidence=ECO:0000305 156..160 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 297..301 3/3 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10831
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.