DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9747 and ADS4

DIOPT Version :9

Sequence 1:NP_001287604.1 Gene:CG9747 / 43591 FlyBaseID:FBgn0039754 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_172124.2 Gene:ADS4 / 837146 AraportID:AT1G06350 Length:300 Species:Arabidopsis thaliana


Alignment Length:298 Identity:85/298 - (28%)
Similarity:140/298 - (46%) Gaps:50/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 WQFQAPLKWDKVIQISLLHIVAGICLLTYPLRELNPYTTIWSFFVGGVAGF-----GVTAGAHRF 160
            :|.|.||.  .|::.|::.||..:|||.       |:...|.....|:..|     .:|...||.
plant    25 FQRQWPLV--DVVRASVVVIVHFLCLLA-------PFNFKWEALRFGLVLFALTTLSITFSFHRN 80

  Fly   161 WTHKSYKANTVLRSILMVCYCVAGQNTLYDWVRDHRVHHKYSETDADPHNANRGFFFSHVGWLMM 225
            .:|:|:|....|..........|.|....|||..||.||:::::|.|||:...|..|||:.|:..
plant    81 LSHRSFKIPKWLEYPWAYSAVFALQGDPMDWVSIHRFHHQFTDSDRDPHSPKEGLLFSHILWIFD 145

  Fly   226 LKHPEVLRRGRQIDMSDILADPVVRFHQKYFIPLKTFFCFILPTV-IPVYCWGETWTLAFIQQCL 289
            .::.:....||         |.|:...:::      |:.|:..|: :.:..:   ||:.::...|
plant   146 TQYIKYKCGGR---------DNVLDLKKQW------FYKFLRRTIAVHILMF---WTILYLYGGL 192

  Fly   290 FRYVS---------SLNFTWSVNSAAHLWGSRPYDKRIMPSENI-YVSLLAMGEGWHNYHHVFPW 344
             .|::         ..:.||.||||.|:||||.::.: ..|.|: ::||..|||.|||.||.|. 
plant   193 -PYLTCGGGVGIFIGYHVTWLVNSACHIWGSRSWNTK-DTSRNVWWLSLFTMGESWHNNHHAFE- 254

  Fly   345 DYKAAELGN--YTVNFTTMVLDAFHKLGWAWNMKQPSK 380
              .:|..|.  :.::.|..::..|..||.|.::|.||:
plant   255 --SSARQGLEWWQIDITWYLIRLFEVLGIATDVKLPSE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9747NP_001287604.1 Delta9-FADS-like 135..376 CDD:239582 71/258 (28%)
FA_desaturase 140..343 CDD:278890 62/218 (28%)
ADS4NP_172124.2 PLN02220 1..300 CDD:177866 85/298 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.