DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9747 and ADS1

DIOPT Version :9

Sequence 1:NP_001287604.1 Gene:CG9747 / 43591 FlyBaseID:FBgn0039754 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_172098.1 Gene:ADS1 / 837117 AraportID:AT1G06080 Length:305 Species:Arabidopsis thaliana


Alignment Length:331 Identity:93/331 - (28%)
Similarity:147/331 - (44%) Gaps:63/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 AIDLEEYTRTFVGDRV-LG------WQFQAPLKWDK--VIQISLLHIVAGICLLTYPLRELNPYT 138
            |.:.||..:....|:. :|      |:    .||.:  :::......|..:|||.       |:.
plant     5 ASEKEENNKKMAADKAEMGRKKRAMWE----RKWKRLDIVKAFASLFVHFLCLLA-------PFN 58

  Fly   139 TIW-----SFFVGGVAGFGVTAGAHRFWTHKSYKANTVLRSILMVCYCVAGQNTLYDWVRDHRVH 198
            ..|     :..|..|.|.|:|...||...|:|:|....|......|..:|.|....|||..||.|
plant    59 FTWPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTHRYH 123

  Fly   199 HKYSETDADPHNANRGFFFSHVGWLMMLKHPEVLRRGRQIDMSDILADPVVRFHQKYFIPLKTFF 263
            |:::::|.|||:.|.||:|||:.||....: .|.:.||:.::.|:......:|.|:..:.....|
plant   124 HQFTDSDRDPHSPNEGFWFSHLLWLFDTGY-LVEKCGRRTNVEDLKRQWYYKFLQRTVLYHILTF 187

  Fly   264 CFILPTVIPVYCWGE----TWTLAFIQQCLFRYVSSLNFTWSVNSAAHLWGSRPYDKRIMPSENI 324
            .|:|      |.:|.    ||.:. |...:..:|:.|     :||..|:||||.: |....|.|:
plant   188 GFLL------YYFGGLSFLTWGMG-IGVAMEHHVTCL-----INSLCHVWGSRTW-KTNDTSRNV 239

  Fly   325 -YVSLLAMGEGWHNYHHVFP---------WDYKAAELGNYTVNFTTMVLDAFHKLGWAWNMKQPS 379
             ::|:.:.||.|||.||.|.         |.   .::..|.|.|..::       |.|.::|.||
plant   240 WWLSVFSFGESWHNNHHAFESSARQGLEWWQ---IDISWYIVRFLEII-------GLATDVKLPS 294

  Fly   380 KELVRR 385
            :...||
plant   295 ESQRRR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9747NP_001287604.1 Delta9-FADS-like 135..376 CDD:239582 76/259 (29%)
FA_desaturase 140..343 CDD:278890 68/212 (32%)
ADS1NP_172098.1 PLN02220 1..305 CDD:177866 93/331 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.