DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9747 and ADS2

DIOPT Version :9

Sequence 1:NP_001287604.1 Gene:CG9747 / 43591 FlyBaseID:FBgn0039754 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001323798.1 Gene:ADS2 / 817694 AraportID:AT2G31360 Length:307 Species:Arabidopsis thaliana


Alignment Length:309 Identity:89/309 - (28%)
Similarity:138/309 - (44%) Gaps:59/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 WQFQAPLKWDK------VIQISLLHIVAGICLLTYPLRELNPYTTIWS-----FFVGGVAGFGVT 154
            |.|     ||:      .::.|....|..:.||.       |:...||     |....:.|.|:|
plant    29 WVF-----WDRRWRRLDYVKFSASFTVHSLALLA-------PFYFTWSALWVTFLFYTIGGLGIT 81

  Fly   155 AGAHRFWTHKSYKANTVLRSILMVCYCVAGQNTLYDWVRDHRVHHKYSETDADPHNANRGFFFSH 219
            ...||...|:|:|....|..:|..|..:|.|....|||..||.||::::::.|||:...||:|||
plant    82 VSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVSTHRYHHQFTDSERDPHSPKEGFWFSH 146

  Fly   220 VGWLMMLKHPEVLRRGRQIDMSDILADPVVRFHQK---YFIPLKTFFCFILPTVIPVYCWGETWT 281
            :.|:....: .|.:.||:.::.|:......||.||   :.|....||.|.|..:..|     ||.
plant   147 LLWIYDSAY-LVSKCGRRANVEDLKRQWFYRFLQKTVLFHILGLGFFLFYLGGMSFV-----TWG 205

  Fly   282 LAFIQQCLFRYVSSLNFTWSVNSAAHLWGSRPYDKRIMPSENI-YVSLLAMGEGWHNYHHVFP-- 343
            :. :...|..:|:.|     :||..|:||:|.: |....|.|: ::|:.:.||.|||.||.|.  
plant   206 MG-VGAALEVHVTCL-----INSLCHIWGTRTW-KTNDTSRNVWWLSVFSFGESWHNNHHAFESS 263

  Fly   344 -------WDYKAAELGNYTVNFTTMVLDAFHKLGWAWNMKQPSKELVRR 385
                   |.   .::..|.|.|       |..:|.|.::|.|::...||
plant   264 ARQGLEWWQ---IDISWYIVRF-------FEIIGLATDVKVPTEAQRRR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9747NP_001287604.1 Delta9-FADS-like 135..376 CDD:239582 77/258 (30%)
FA_desaturase 140..343 CDD:278890 68/211 (32%)
ADS2NP_001323798.1 PLN02220 1..307 CDD:177866 89/309 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.