DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9747 and SCD

DIOPT Version :9

Sequence 1:NP_001287604.1 Gene:CG9747 / 43591 FlyBaseID:FBgn0039754 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_005054.3 Gene:SCD / 6319 HGNCID:10571 Length:359 Species:Homo sapiens


Alignment Length:291 Identity:145/291 - (49%)
Similarity:193/291 - (66%) Gaps:7/291 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 WDKVIQISLLHIVA--GICLLTYPLRELNPYTTIWSFFVGGVAGFGVTAGAHRFWTHKSYKANTV 171
            |..:|.:||||:.|  ||.|:  |..:.  ||.:|..|...|:..|:||||||.|:|:||||...
Human    73 WRNIILMSLLHLGALYGITLI--PTCKF--YTWLWGVFYYFVSALGITAGAHRLWSHRSYKARLP 133

  Fly   172 LRSILMVCYCVAGQNTLYDWVRDHRVHHKYSETDADPHNANRGFFFSHVGWLMMLKHPEVLRRGR 236
            ||..|::...:|.||.:|:|.||||.|||:|||.|||||:.|||||||||||::.|||.|..:|.
Human   134 LRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGS 198

  Fly   237 QIDMSDILADPVVRFHQKYFIPLKTFFCFILPTVIPVYCWGETWTLAFIQQCLFRYVSSLNFTWS 301
            .:|:||:.|:.:|.|.::|:.|.....||||||::|.|.||||:..:.......||...||.||.
Human   199 TLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGETFQNSVFVATFLRYAVVLNATWL 263

  Fly   302 VNSAAHLWGSRPYDKRIMPSENIYVSLLAMGEGWHNYHHVFPWDYKAAELGNYTVNFTTMVLDAF 366
            |||||||:|.|||||.|.|.|||.|||.|:|||:|||||.||:||.|:|. .:.:||||..:|..
Human   264 VNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNYHHSFPYDYSASEY-RWHINFTTFFIDCM 327

  Fly   367 HKLGWAWNMKQPSKELVRRTLEKYGDGTHAS 397
            ..||.|::.|:.||..:...:::.|||.:.|
Human   328 AALGLAYDRKKVSKAAILARIKRTGDGNYKS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9747NP_001287604.1 Delta9-FADS-like 135..376 CDD:239582 127/240 (53%)
FA_desaturase 140..343 CDD:278890 111/202 (55%)
SCDNP_005054.3 Delta9-FADS-like 100..337 CDD:239582 126/237 (53%)
FA_desaturase 102..306 CDD:278890 112/203 (55%)
Histidine box-1. /evidence=ECO:0000305 120..125 3/4 (75%)
Histidine box-2. /evidence=ECO:0000305 157..161 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 298..302 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.