DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9747 and CG9743

DIOPT Version :9

Sequence 1:NP_001287604.1 Gene:CG9747 / 43591 FlyBaseID:FBgn0039754 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_651781.1 Gene:CG9743 / 43593 FlyBaseID:FBgn0039756 Length:420 Species:Drosophila melanogaster


Alignment Length:314 Identity:146/314 - (46%)
Similarity:191/314 - (60%) Gaps:13/314 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 KDAIDLEEYTRTFVGDRVLGWQFQAPLKWDKVIQISLLHIVAGICLLTYPLRELNPYTTIWSFFV 145
            |:|..:||..           ::...::|..:...:.|||  |.....|.|...|.||.:|....
  Fly    86 KEAEQVEEEE-----------EYHPQIRWPDLGAQAFLHI--GALYGLYQLFYANFYTFLWVVVT 137

  Fly   146 GGVAGFGVTAGAHRFWTHKSYKANTVLRSILMVCYCVAGQNTLYDWVRDHRVHHKYSETDADPHN 210
            ..|:|.|:||||||.|:||||.|:..||.:|...:.:|||...|.|..|||:|||:|||||||||
  Fly   138 VWVSGIGITAGAHRLWSHKSYTASLPLRILLAFAFSIAGQRDAYTWALDHRIHHKFSETDADPHN 202

  Fly   211 ANRGFFFSHVGWLMMLKHPEVLRRGRQIDMSDILADPVVRFHQKYFIPLKTFFCFILPTVIPVYC 275
            |.|||||:|||||.:..||:|:.:.:.|||||:.||.|..|.:||:|||......|||..:|.|.
  Fly   203 AKRGFFFAHVGWLFLTPHPKVVAKRKVIDMSDLEADAVCMFQRKYYIPLFALCSIILPVAVPWYF 267

  Fly   276 WGETWTLAFIQQCLFRYVSSLNFTWSVNSAAHLWGSRPYDKRIMPSENIYVSLLAMGEGWHNYHH 340
            |.|...::|......|:..:||..:.|||.||::|::||||.:|.:|...|||||||||||||||
  Fly   268 WNEDLWMSFWINFNMRFTWTLNVAFFVNSVAHMYGNKPYDKNLMSTEAPIVSLLAMGEGWHNYHH 332

  Fly   341 VFPWDYKAAELGNYTVNFTTMVLDAFHKLGWAWNMKQPSKELVRRTLEKYGDGT 394
            |||||||..|.|||::|.||..:|....||.|...|..|.::|.|..:|.||||
  Fly   333 VFPWDYKTGEFGNYSLNITTGFIDFCAWLGLAKGRKSVSPDMVLRRAKKCGDGT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9747NP_001287604.1 Delta9-FADS-like 135..376 CDD:239582 126/240 (53%)
FA_desaturase 140..343 CDD:278890 106/202 (52%)
CG9743NP_651781.1 Delta9-FADS-like 130..368 CDD:239582 124/237 (52%)
FA_desaturase 131..335 CDD:278890 106/203 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
Isobase 1 0.950 - 0.837287 Normalized mean entropy S1208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
109.920

Return to query results.
Submit another query.